PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do022640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 323aa    MW: 34410.4 Da    PI: 9.1515
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do022640.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof101.74.4e-321372261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                +e+ l cprC st+tkfCyynnyslsqPr+fC++CrryWt+GGalr++P  ++ ++++++
  Do022640.1 13 PESGLMCPRCRSTETKFCYYNNYSLSQPRHFCRTCRRYWTHGGALRDLPFSSSIQRRRRR 72
                677899********************************************9986555443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-24161IPR003851Zinc finger, Dof-type
PfamPF027017.2E-291770IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.3851771IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101955IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MMELARLAKI PQPESGLMCP RCRSTETKFC YYNNYSLSQP RHFCRTCRRY WTHGGALRDL  60
PFSSSIQRRR RRNKSSNKHT SSKVASCASG TGARASSSSS SSGATVPSGR VEQLPLSLAP  120
LDPVGGAERH RTGASRLWFP RHSSQDPVGY RQLGNSIGAA TTIRPENQCY IPQRQPPFSF  180
LGYKNAVTAA TSAICPFSAE AGGSEAGSFA GQMQAISFSR VPGSAEPASE VMAAVVENPP  240
IISSTETMME TWMSSPGEEF LAGLQGENDL LRFLGSGSWA CGYGYTAGNG ASSRGSSCTV  300
APGDAWPDPS GFASSFSGRS TIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK4ABT41e-131K4ABT4_SETIT; Uncharacterized protein
STRINGSi036341m1e-130(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2288456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.12e-29OBF-binding protein 3